missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPI17 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37897-25ul
This item is not returnable.
View return policy
Description
CPI17 alpha Polyclonal specifically detects CPI17 alpha in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CPI17 alpha | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Simple Western reported by internal validation, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q96A00 | |
| PPP1R14A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR | |
| 25 μL | |
| Protein Phosphatase | |
| 94274 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction