missing translation for 'onlineSavingsMsg'
Learn More

CRM1 Antibody [CoraFluorÖ 1], Novus Biologicals Biologicals™

Product Code. 30497548 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30497548 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30497548 Supplier Novus Biologicals Supplier No. NBP335072CL1

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CRM1 Polyclonal antibody specifically detects CRM1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CRM1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate CoraFluor 1
Formulation PBS
Gene Alias Chromosome region maintenance 1 protein homolog, DKFZp686B1823, emb, exp1, exportin 1 (CRM1 homolog, yeast), exportin 1 (CRM1, yeast, homolog), exportin-1, Exportin-1 (required for chromosome region maintenance), yeast, homolog
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1).,, Sequence:, PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 7514
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark. Do not freeze.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.