missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRMP4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | CRMP4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627691
|
Novus Biologicals
NBP2-92073-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678211
|
Novus Biologicals
NBP2-92073-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CRMP4 Polyclonal antibody specifically detects CRMP4 in Mouse, Rat samples. It is validated for Western BlotSpecifications
| CRMP4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS with 50% glycerol, pH7.3. | |
| 1809 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| Collapsin response mediator protein 4, CRMP-4, CRMP4collapsin response mediator protein 4 long, dihydropyrimidinase-like 3, DRP-3dihydropyrimidinase-related protein 3, DRP3ULIP1, ULIP-1, ULIPLCRMP, Unc-33-like phosphoprotein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human CRMP4 (NP_001378.1). RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title