missing translation for 'onlineSavingsMsg'
Learn More
Learn More
csl/RBPJK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 560.70
Specifications
| Antigen | csl/RBPJK |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18200733
|
Novus Biologicals
NBP2-56071 |
100 μL |
€ 593.00 € 560.70 / 100µL Save € 32.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18645848
|
Novus Biologicals
NBP2-56071-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
csl/RBPJK Polyclonal specifically detects csl/RBPJK in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| csl/RBPJK | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CBF-1, csl, H-2K binding factor-2, IGKJRB1RBPSUHCBF1, IGKJRBRBP-J kappa, immunoglobulin kappa J region recombination signal binding protein 1, J kappa-recombination signal-binding protein, KBF2, RBP-JK, RBPJKMGC61669, RBP-Jrecombining binding protein suppressor of hairless (Drosophila), recombination signal binding protein for immunoglobulin kappa J region, recombining binding protein suppressor of hairless, Renal carcinoma antigen NY-REN-30, SUH, suppressor of hairless homolog | |
| RBPJ | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3516 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title