missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSN7b Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 288.00 - € 539.00
Specifications
| Antigen | CSN7b |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18658515
|
Novus Biologicals
NBP2-38214-25ul |
25 μL |
€ 288.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18110398
|
Novus Biologicals
NBP2-38214 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CSN7b Polyclonal specifically detects CSN7b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CSN7b | |
| Polyclonal | |
| Rabbit | |
| Growth and Development, Neuronal Cell Markers, Neurotransmission, Signal Transduction, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Arabidopsis, homolog) subunit 7B, COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis), COP9 signalosome complex subunit 7b, CSN7BMGC111077, FLJ12612, Signalosome subunit 7b | |
| COPS7B | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9H9Q2 | |
| 64708 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title