missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CT45A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 556.50
Especificaciones
| Antigen | CT45A1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
18642306
|
Novus Biologicals
NBP2-46704-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18679085
|
Novus Biologicals
NBP2-46704 |
0.1 mL |
 € 589.00 € 556.50 / 0.10mL Save € 32.50 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
CT45A1 Polyclonal antibody specifically detects CT45A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Especificaciones
| CT45A1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Q8N7B7 | |
| 541466 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| Cancer/testis antigen 45-1, Cancer/testis antigen 45A1, cancer/testis antigen CT45-1, cancer/testis antigen family 45 member A1, cancer/testis antigen family 45, member A1, CT45, CT45.1, CT45-1XX-FW88277B6.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto