missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85512
This item is not returnable.
View return policy
Description
CTR2 Polyclonal specifically detects CTR2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC | |
| IgG |
| Polyclonal | |
| Copper transporter 2, COPT2SLC13A2, CTR2Solute carrier family 31 member 2, hCTR2probable low affinity copper uptake protein 2, solute carrier family 31 (copper transporters), member 2 | |
| 0.1 mL |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction