missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTR9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49547
This item is not returnable.
View return policy
Description
CTR9 Polyclonal antibody specifically detects CTR9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| CTR9 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae), KIAA0155SH2 domain-binding protein 1, p150TSP, RNA polymerase-associated protein CTR9 homolog, SH2 domain binding protein 1 (tetratricopeptide repeat containing), SH2BP1p150, TPR-containing, SH2-binding phosphoprotein, TSBP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH | |
| 0.1 mL | |
| Chromatin Research | |
| 9646 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction