missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Cullin 4a Polyclonal antibody specifically detects Cullin 4a in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Cullin 4a |
| Applications | ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 405 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CUL-4A, cullin 4A, cullin-4A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-300 of human Cullin 4a (NP_001008895.1).,, Sequence:, IERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?