missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXADR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88194
This item is not returnable.
View return policy
Description
CXADR Polyclonal antibody specifically detects CXADR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CXADR | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
| CAR10Coxsackievirus B-adenovirus receptor, CAR4/6, coxsackie virus and adenovirus receptor, coxsackie virus B receptor, coxsackievirus and adenovirus receptor, CVB3 binding protein, CVB3-binding protein, hCAR, HCVADR | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK | |
| 0.1 mL | |
| Cell Biology, Stem Cell Markers, Virology Bacteria and Parasites | |
| 1525 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction