missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR7/RDC-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | CXCR7/RDC-1 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18473202
|
Novus Biologicals
NBP2-13885-25ul |
25ul |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18036887
|
Novus Biologicals
NBP2-13885 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CXCR7/RDC-1 Polyclonal specifically detects CXCR7/RDC-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CXCR7/RDC-1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| chemokine (C-X-C motif) receptor 7, Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7, CXC-R7, CXCR-7, G protein-coupled receptor, GPR159G-protein coupled receptor 159, RDC-1, RDC1G-protein coupled receptor RDC1 homolog | |
| ACKR3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 57007 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title