missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 671.00
Specifications
| Antigen | Cyclin A2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18422251
|
Novus Biologicals
NBP1-88156-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18444261
|
Novus Biologicals
NBP1-88156 |
0.1 mL |
€ 671.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cyclin A2 Polyclonal antibody specifically detects Cyclin A2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Cyclin A2 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, Stem Cell Markers, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol | |
| 890 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CCN1CCNAcyclin-A, cyclin A2, Cyclin-A, cyclin-A2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title