missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15935415

Invitrogen™ Cytochrome P450 Reductase Polyclonal Antibody
GREENER_CHOICE

Product Code. 15935415
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15935415 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15935415 Supplier Invitrogen™ Supplier No. PA579848

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human HepG2 whole cell, human CACO-2 whole cell, human K562 whole cell, rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. IHC: Mouse Intestine tissue, Rat Intestine tissue, Human Mammary Cancer tissue. Flow: K562 cell, SiHa cell.

This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytochrome P450 Reductase
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene POR
Gene Accession No. P00388, P16435, P37040
Gene Alias 4933424M13Rik; CCR; CPR; CY DKFZp686G04235; CYPOR; cytochrome p450 oxidoreductase; cytochrome P450 reductase; DKFZp686G04235; FLJ26468; I79_007261; LOC101115252; NADPH Cytochrome; NADPH-cytochrome P450 oxidoreductase; NADPH-cytochrome P-450 oxidoreductase; NADPH-cytochrome P450 reductase; NADPH--cytochrome P450 reductase; NADPH-cytochrome P-450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450 Reductase; P450R; Por; unnamed protein product
Gene Symbols POR
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 18984, 29441, 5447
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.