missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytokeratin 15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85603
This item is not returnable.
View return policy
Description
Cytokeratin 15 Polyclonal antibody specifically detects Cytokeratin 15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Cytokeratin 15 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| CK15, CK-15, cytokeratin 15, cytokeratin-15, K15keratin-15, basic, K1CO, keratin 15, keratin, type I cytoskeletal 15, Keratin-15, keratin-15, beta, KRTB, type I cytoskeletal 15 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI | |
| 0.1 mL | |
| Cell Biology, Cellular Markers | |
| 3866 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction