missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody - Azide and BSA Free, Novus Biologicals™

Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. p-200061364 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18670721 0.02 mL 0.02mL
18677120 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18670721 Supplier Novus Biologicals Supplier No. NBP2922330.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Cytosolic Sulfotransferase 1C4/SULT1C4 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 1C4/SULT1C4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytosolic Sulfotransferase 1C4/SULT1C4
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2). MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 27233
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.