missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | Cytosolic Sulfotransferase 1C4/SULT1C4 |
|---|---|
| Dilution | Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18670721
|
Novus Biologicals
NBP2-92233-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677120
|
Novus Biologicals
NBP2-92233-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cytosolic Sulfotransferase 1C4/SULT1C4 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 1C4/SULT1C4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Cytosolic Sulfotransferase 1C4/SULT1C4 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Endocrinology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 27233 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2). MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title