missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | Cytosolic Sulfotransferase 2A1/SULT2A1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18432792
|
Novus Biologicals
NBP2-32604-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18180135
|
Novus Biologicals
NBP2-32604 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cytosolic Sulfotransferase 2A1/SULT2A1 Polyclonal specifically detects Cytosolic Sulfotransferase 2A1/SULT2A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Cytosolic Sulfotransferase 2A1/SULT2A1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| alcohol/hydroxysteroid sulfotransferase, Dehydroepiandrosterone sulfotransferase, DHEAS, DHEA-STbile salt sulfotransferase, EC 2.8.2.14, HST, hSTa, Hydroxysteroid Sulfotransferase, ST2, ST2A1, ST2A3, STDbile-salt sulfotranasferase 2A1, Sulfotransferase 2A1, sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone(DHEA)-preferring, member 1 | |
| SULT2A1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6822 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title