missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49402
This item is not returnable.
View return policy
Description
Cytosolic Sulfotransferase 2A1/SULT2A1 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 2A1/SULT2A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Cytosolic Sulfotransferase 2A1/SULT2A1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| alcohol/hydroxysteroid sulfotransferase, Dehydroepiandrosterone sulfotransferase, DHEAS, DHEA-STbile salt sulfotransferase, EC 2.8.2.14, HST, hSTa, Hydroxysteroid Sulfotransferase, ST2, ST2A1, ST2A3, STDbile-salt sulfotranasferase 2A1, Sulfotransferase 2A1, sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone(DHEA)-preferring, member 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 6822 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction