missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAGLA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00 - € 624.00
Specifications
| Antigen | DAGLA |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471442
|
Novus Biologicals
NBP2-31856-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18141282
|
Novus Biologicals
NBP2-31856 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DAGLA Polyclonal specifically detects DAGLA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DAGLA | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C11orf11, DAGL(ALPHA), DAGLALPHA, DGL-alpha, diacylglycerol lipase, alpha, EC 3.1.1.-, KIAA0659, Neural stem cell-derived dendrite regulator, NSDDRchromosome 11 open reading frame 11, sn1-specific diacylglycerol lipase alpha | |
| DAGLA | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9Y4D2 | |
| 747 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title