missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DARPP-32 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | DARPP-32 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18628695
|
Novus Biologicals
NBP2-38908-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18190659
|
Novus Biologicals
NBP2-38908 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DARPP-32 Polyclonal specifically detects DARPP-32 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DARPP-32 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9UD71 | |
| 84152 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Neuronal Cell Markers, Neuroscience, Neurotransmission, Protein Phosphatase, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| protein phosphatase 1, regulatory (inhibitor) subunit 1B, regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32) | |
| PPP1R1B | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title