missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCAF12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92323-0.02ml
This item is not returnable.
View return policy
Description
DCAF12 Polyclonal antibody specifically detects DCAF12 in Human, Rat samples. It is validated for Western Blot
Specifications
| DCAF12 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DDB1- and CUL4-associated factor 12, CT102, DDB1 and CUL4 associated factor 12, KIAA1892, TCC52, WDR40A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1). MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFH | |
| 0.02 mL | |
| Cell Biology | |
| 25853 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction