missing translation for 'onlineSavingsMsg'
Learn More

DCBLD2/ESDN Antibody (3G10), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00131566-M01

Product Code. 18468989

€ 622.00 / 0.10mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DCBLD2/ESDN Monoclonal antibody specifically detects DCBLD2/ESDN in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA

Specifications

Antigen	DCBLD2/ESDN
Classification	Monoclonal
Conjugate	Unconjugated
Gene Accession No.	NP_563615
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	ELISA, Immunocytochemistry/Immunofluorescence, Sandwich ELISA
Clone	3G10
Formulation	In 1x PBS, pH 7.4
Gene Alias	CLCP11700055P21Rik, CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, discoidin, CUB and LCCL domain containing 2, discoidin, CUB and LCCL domain-containing protein 2, Endothelial and smooth muscle cell-derived neuropilin-like protein, ESDNcoagulation factor V/VIII-homology domains protein 1
Immunogen	DCBLD2 (NP_563615.3, 80 a.a. ∽ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE
Quantity	0.1 mg
Research Discipline	Signal Transduction
Gene ID (Entrez)	131566
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG2a κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

DCBLD2/ESDN Antibody (3G10), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions