missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 575.40
Specifications
| Antigen | DCC |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18035026
|
Novus Biologicals
NBP2-56793 |
100 μL |
€ 609.00 € 575.40 / 100µL Save € 33.60 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669828
|
Novus Biologicals
NBP2-56793-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DCC Polyclonal specifically detects DCC in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DCC | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1630 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Colorectal cancer suppressor, CRC18, CRCR1, deleted in colorectal cancer protein, deleted in colorectal carcinoma, IGDCC1colorectal tumor suppressor, Immunoglobulin superfamily DCC subclass member 1, immunoglobulin superfamily, DCC subclass, member 1, netrin receptor DCC, Tumor suppressor protein DCC | |
| DCC | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title