missing translation for 'onlineSavingsMsg'
Learn More

DDI2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

€ 391.65 - € 590.10

Specifications

Antigen	DDI2
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18137277 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-47492	0.1 mL	€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18629095 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-47492-25ul	25 μL	€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

DDI2 Polyclonal specifically detects DDI2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	DDI2
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	DDI1, DNA-damage inducible 1, homolog 2, DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae), DNA-damage inducible 1 homolog 2 (S. cerevisiae), DNA-damage inducible protein 2 (DDI2), MGC14844, protein DDI1 homolog 2, RP4-680D5.5
Gene Symbols	DDI2
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	84301
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: VDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

DDI2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents