missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX50 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | DDX50 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246442
|
Novus Biologicals
NBP2-55077 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633907
|
Novus Biologicals
NBP2-55077-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DDX50 Polyclonal specifically detects DDX50 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DDX50 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 79009 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ATP-dependent RNA helicase DDX50, DEAD (Asp-Glu-Ala-Asp) box polypeptide 50, DEAD box protein 50, EC 3.6.1, EC 3.6.4.13, GU2, GUB, gu-beta, MGC3199, Nucleolar protein Gu2, RH-II/GuB, RNA helicase II/Gu beta | |
| DDX50 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title