missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX6 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | DDX6 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226899
|
Novus Biologicals
NBP3-33553-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232232
|
Novus Biologicals
NBP3-33553-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DDX6 Monoclonal antibody specifically detects DDX6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| DDX6 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Tumor Suppressors | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1656 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD box protein 6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), EC 3.6.1, EC 3.6.4.13, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, RCKP54 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196).,, Sequence:, YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title