missing translation for 'onlineSavingsMsg'
Learn More

DECR2 Antibody (4A7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00026063-M03

Product Code. 18420650

€ 589.00 / 0.01mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DECR2 Monoclonal antibody specifically detects DECR2 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA

Specifications

Antigen	DECR2
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	2,4-dienoyl CoA reductase 2, peroxisomal, EC 1.3.1, EC 1.3.1.34, pDCR2,4-dienoyl-CoA reductase 2, PDCRshort chain dehydrogenase/reductase family 17C, member 1, peroxisomal 2,4-dienoyl-CoA reductase, SDR17C1
Immunogen	DECR2 (AAH10740.1, 49 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI
Quantity	0.1 mg
Research Discipline	Lipid and Metabolism
Gene ID (Entrez)	26063
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG2a κ

Applications	Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA
Clone	4A7
Dilution	Western Blot 1:500
Gene Accession No.	AAH10740
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

DECR2 Antibody (4A7), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions