missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEGS1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | DEGS1 |
|---|---|
| Dilution | Western Blot 1:1000-1:3000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643231
|
Novus Biologicals
NBP2-92082-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18623160
|
Novus Biologicals
NBP2-92082-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DEGS1 Polyclonal antibody specifically detects DEGS1 in Human samples. It is validated for Western BlotSpecifications
| DEGS1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology | |
| PBS with 50% glycerol, pH7.3. | |
| 8560 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000-1:3000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 234-323 of human DEGS1 (NP_003667.1). YMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title