missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DFF45/ICAD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifications
| Antigen | DFF45/ICAD |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18460172
|
Novus Biologicals
NBP1-85249-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18489901
|
Novus Biologicals
NBP1-85249 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DFF45/ICAD Polyclonal antibody specifically detects DFF45/ICAD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| DFF45/ICAD | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1676 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DFF1DNA fragmentation factor 45 kDa subunit, DFF45DNA fragmentation factor subunit alpha, DFF-45DNA fragmentation factor, 45 kD, alpha polypeptide, DNA fragmentation factor, 45kDa, alpha polypeptide, ICAD, Inhibitor of CAD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title