missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DGAT2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 193.00 - € 463.00
Specifications
| Antigen | DGAT2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18635812
|
Novus Biologicals
NBP2-92727-0.02ml |
0.02 mL |
€ 193.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693222
|
Novus Biologicals
NBP2-92727-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DGAT2 Polyclonal antibody specifically detects DGAT2 in Mouse, Rat samples. It is validated for Western BlotSpecifications
| DGAT2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS with 50% glycerol, pH7.3. | |
| 84649 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| diacylglycerol O-acyltransferase 2, diacylglycerol O-acyltransferase homolog 2, diacylglycerol O-acyltransferase homolog 2 (mouse), diacylglycerol O-acyltransferase-like protein 2, Diglyceride acyltransferase 2, DKFZp686A15125, EC 2.3.1, EC 2.3.1.20, GS1999FULL | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2). IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title