missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DGK-delta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13917
This item is not returnable.
View return policy
Description
DGK-delta Polyclonal specifically detects DGK-delta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DGK-delta | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| 130 kDa diacylglycerol kinase, DAG kinase delta, dgkd-2, DGKdelta, DGK-delta, diacylglycerol kinase delta, diacylglycerol kinase, delta (130kD), diacylglycerol kinase, delta 130kDa, Diglyceride kinase delta, FLJ26930, KIAA0145EC 2.7.1.107 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DGKD | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 8527 | |
| Human | |
| IgG |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?
For Research Use Only