missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DGK-delta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13917-25ul
This item is not returnable.
View return policy
Description
DGK-delta Polyclonal specifically detects DGK-delta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DGK-delta | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| 130 kDa diacylglycerol kinase, DAG kinase delta, dgkd-2, DGKdelta, DGK-delta, diacylglycerol kinase delta, diacylglycerol kinase, delta (130kD), diacylglycerol kinase, delta 130kDa, Diglyceride kinase delta, FLJ26930, KIAA0145EC 2.7.1.107 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DGKD | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS | |
| 25ul | |
| Lipid and Metabolism | |
| 8527 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction