missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHTKD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | DHTKD1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205643
|
Novus Biologicals
NBP2-57835 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664717
|
Novus Biologicals
NBP2-57835-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DHTKD1 Polyclonal specifically detects DHTKD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DHTKD1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55526 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| dehydrogenase E1 and transketolase domain containing 1, Dehydrogenase E1 and transketolase domain-containing protein 1, DKFZp762M115, EC 1.2.4.2, KIAA1630DKFZP762M115, MGC3090, probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial | |
| DHTKD1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title