missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DIDO1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | DIDO1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18457241
|
Novus Biologicals
NBP2-33269-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18133933
|
Novus Biologicals
NBP2-33269 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DIDO1 Polyclonal specifically detects DIDO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DIDO1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BYE1, C20orf158, DATF-1, DATF1DIDO3, death associated transcription factor 1, death inducer-obliterator 1, Death-associated transcription factor 1, death-inducer obliterator 1, DIO1DIDO2, DIO-1hDido1, dJ885L7.8, DKFZp434P1115, FLJ11265, KIAA0333chromosome 20 open reading frame 158, MGC16140 | |
| DIDO1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9BTC0 | |
| 11083 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title