missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit anti-Human, Rat, Clone: 1Q5F6, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 190.00 - € 496.00
Specifications
| Antigen | Dimethylarginine Dimethylaminohydrolase 1/DDAH1 |
|---|---|
| Clone | 1Q5F6 |
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18396796
|
Novus Biologicals
NBP3-16444-20UL |
20 μg |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18326144
|
Novus Biologicals
NBP3-16444-100UL |
100 μg |
€ 496.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Monoclonal antibody specifically detects Dimethylarginine Dimethylaminohydrolase 1/DDAH1 in Human, Rat samples. It is validated for Western BlotSpecifikationer
| Dimethylarginine Dimethylaminohydrolase 1/DDAH1 | |
| Western Blot 1:500 - 1:2000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| DDAH-1, DDAHdimethylargininase-1, DDAHI, Dimethylargininase-1, dimethylarginine dimethylaminohydrolase 1FLJ25539, EC 3.5.3.18, FLJ21264, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, NG, NG-dimethylarginine dimethylaminohydrolase | |
| A synthetic peptide corresponding to a sequence within amino acids 186-285 of human Dimethylarginine Dimethylaminohydrolase 1/DDAH1 (O94760). IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 1Q5F6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 23576 | |
| IgG | |
| Affinity purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel