missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLK2/EGFL9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | DLK2/EGFL9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18202725
|
Novus Biologicals
NBP2-55737 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667928
|
Novus Biologicals
NBP2-55737-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
DLK2/EGFL9 Polyclonal specifically detects DLK2/EGFL9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| DLK2/EGFL9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| delta-like 2 homolog (Drosophila), DLK-2, EGFL9, EGF-like protein 9, EGF-like-domain, multiple 9, Epidermal growth factor-like protein 9, MGC111055, MGC2487, protein delta homolog 2 | |
| DLK2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 65989 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts