missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49506
This item is not returnable.
View return policy
Description
DNAH2 Polyclonal antibody specifically detects DNAH2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| DNAH2 | |
| Polyclonal | |
| Western Blot -Reported in scientific literature (PMID: 30811583), Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Axonemal Beta Dynein Heavy Chain 2, Ciliary Dynein Heavy Chain 2, DNAHC2, DNHD3, Dynein Heavy Chain Domain 3, Dynein Heavy Chain Domain-Containing Protein 3, Dynein, Axonemal, Heavy Chain 2, KIAA1503 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALL | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 146754 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction