missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJB5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | DNAJB5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18254093
|
Novus Biologicals
NBP2-58535 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627268
|
Novus Biologicals
NBP2-58535-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJB5 Polyclonal specifically detects DNAJB5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DNAJB5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 25822 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| DnaJ (Hsp40) homolog, subfamily B, member 5, heat shock cognate 40, Heat shock protein cognate 40, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, HSC40, Hsc40dnaJ homolog subfamily B member 5, KIAA1045 | |
| DNAJB5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title