missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC18 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | DNAJC18 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18616100
|
Novus Biologicals
NBP2-92387-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18689890
|
Novus Biologicals
NBP2-92387-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJC18 Polyclonal antibody specifically detects DNAJC18 in Human, Rat samples. It is validated for Western BlotSpecifications
| DNAJC18 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 202052 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| DnaJ (Hsp40) homolog, subfamily C, member 18, dnaJ homolog subfamily C member 18, MGC29463 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human DNAJC18 (NP_689899.1). STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title