missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC5G Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | DNAJC5G |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18118118
|
Novus Biologicals
NBP2-38484 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18670176
|
Novus Biologicals
NBP2-38484-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJC5G Polyclonal specifically detects DNAJC5G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DNAJC5G | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8N7S2 | |
| 285126 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CSP-gamma, DnaJ (Hsp40) homolog, subfamily C, member 5 gamma, dnaJ homolog subfamily C member 5G, FLJ40417, gamma cysteine string protein, gamma-CSP, Gamma-cysteine string protein | |
| DNAJC5G | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title