missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16151690

Abnova™ dnaK (Escherichia coli) Recombinant Protein

Product Code. 16151690
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
This item is not returnable. View return policy

Product Code. 16151690

Brand: Abnova™ P4962.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for SDS-PAGE

Sequence: MDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHST

Specifications

Accession Number NP_414555
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 944750
Molecular Weight (g/mol) 10.4kDa
Name dnaK (Escherichia coli) Recombinant protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing 15% SDS-PAGE Stained with Coomassie Blue
Quantity 100 μg
Immunogen MDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHST
Storage Requirements Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ECK0014/JW0013/groPAB/groPC/groPF/grpC/grpF/seg
Common Name dnaK
Gene Symbol dnaK
Species E. coli
Protein Tag None
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.