missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAM-1/CD226 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68690
This item is not returnable.
View return policy
Description
DNAM-1/CD226 Polyclonal antibody specifically detects DNAM-1/CD226 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| DNAM-1/CD226 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| CD226 antigenplatelet and T cell activation antigen 1, CD226 molecule, DNAM1adhesion glycoprotein, DNAM-1DNAX accessory molecule-1, DNAX accessory molecule 1, PTA1, T lineage-specific activation antigen 1 antigen, TLiSA1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA | |
| 100 μg | |
| Cellular Markers, Innate Immunity, Signal Transduction | |
| 10666 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction