missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DOCK9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38517-25ul
This item is not returnable.
View return policy
Description
DOCK9 Polyclonal specifically detects DOCK9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DOCK9 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q9BZ29 | |
| DOCK9 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LQLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEV | |
| 25 μL | |
| Apoptosis, Cell Biology, Signal Transduction | |
| 23348 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cdc42 guanine nucleotide exchange factor zizimin-1, dedicator of cytokinesis 9, dedicator of cytokinesis protein 9, DKFZp686C11110, DKFZp686D2047, DKFZp686N04132, FLJ11949, FLJ16744, FLJ45601, KIAA1058FLJ44528, KIAA1085, ZIZ1FLJ45282, ZIZIMIN1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction