missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dopamine D3R/DRD3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | Dopamine D3R/DRD3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637691
|
Novus Biologicals
NBP2-92178-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18645500
|
Novus Biologicals
NBP2-92178-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dopamine D3R/DRD3 Polyclonal antibody specifically detects Dopamine D3R/DRD3 in Mouse, Rat samples. It is validated for Western BlotSpecifications
| Dopamine D3R/DRD3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS with 50% glycerol, pH7.3. | |
| 1814 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| D(3) dopamine receptor, D3DR, Dopamine D3 receptor, dopamine receptor D3, essential tremor 1, ETM1, FET1, MGC149204, MGC149205 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine D3R/DRD3 (NP_000787.2). MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title