missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DPPIV/CD26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 329.00 - € 564.00
Specifications
| Antigen | DPPIV/CD26 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18626474
|
Novus Biologicals
NBP3-21319-100ul |
100 μg |
€ 564.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18647614
|
Novus Biologicals
NBP3-21319-25ul |
25 μg |
€ 329.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DPPIV/CD26 Polyclonal antibody specifically detects DPPIV/CD26 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| DPPIV/CD26 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, Cellular Markers, GPCR, Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 1803 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ADABP, ADCP-2, ADCP2DPP IV, Adenosine deaminase complexing protein 2TP103, CD26 antigen, CD26T-cell activation antigen CD26, dipeptidyl peptidase 4, Dipeptidyl peptidase IV, dipeptidylpeptidase 4, dipeptidyl-peptidase 4, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2), DPPIV, EC 3.4.14.5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title