missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DTX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-58472-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
DTX1 Polyclonal specifically detects DTX1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| DTX1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| deltex homolog 1 (Drosophila), deltex1, hDTX1, hDx-1, protein deltex-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| DTX1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP | |
| 25 μL | |
| Signal Transduction | |
| 1840 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto