missing translation for 'onlineSavingsMsg'
Learn More

DTYMK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP1-91850-25ul

Afficher plus de versions de ce produit

Code produit. 18499841

€ 415.00 / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

DTYMK Polyclonal antibody specifically detects DTYMK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Spécification

Antigen	DTYMK
Classification	Polyclonal
Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias	CDC8TMPKTYMKPP3731, deoxythymidylate kinase (thymidylate kinase), dTMP kinase, EC 2.7.4.9, FLJ44192, MGC198617, thymidylate kinase
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: DLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTAT
Quantity	25 μL
Research Discipline	Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)	1841
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

DTYMK Antibody, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions