missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP19 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92468-0.1ml
This item is not returnable.
View return policy
Description
DUSP19 Polyclonal antibody specifically detects DUSP19 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| DUSP19 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| dual specificity phosphatase 19, Dual specificity phosphatase TS-DSP1, dual specificity protein phosphatase 19, DUSP17SAPK pathway-regulating phosphatase 1, EC 3.1.3.16, EC 3.1.3.48, LMWDSP3, LMW-DSP3, Low molecular weight dual specificity phosphatase 3, Protein phosphatase SKRP1, SKRP1MGC138210, Stress-activated protein kinase pathway-regulating phosphatase 1, TS-DSP1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DUSP19 (NP_543152.1). MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHI | |
| 0.1 mL | |
| Protein Phosphatase | |
| 142679 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction