missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00
Specifications
| Antigen | DUSP23 |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DUSP23 Polyclonal specifically detects DUSP23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DUSP23 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| dual specificity phosphatase 23, dual specificity protein phosphatase 23, DUSP25, EC 3.1.3.16, EC 3.1.3.48, FLJ20442, LDP3, LDP-3, Low molecular mass dual specificity phosphatase 3, low-molecular-mass dual-specificity phosphatase 3, MOSP, RP11-190A12.1, VH1-like member Z, VH1-like phosphatase Z, VHZ | |
| DUSP23 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Protein Phosphatase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 54935 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title