missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dynactin Subunit 1/DCTN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP3-21351-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Dynactin Subunit 1/DCTN1 Polyclonal antibody specifically detects Dynactin Subunit 1/DCTN1 in Human samples. It is validated for Immunofluorescence
Especificaciones
| Dynactin Subunit 1/DCTN1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| dynactin 1, dynactin 1 (p150, Glued (Drosophila) homolog), dynactin subunit 1, glued homolog, Drosophila), p135, p150 Glued (Drosophila) homolog, p150-glued | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV | |
| 25 μg | |
| Cell Cycle and Replication | |
| 1639 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido