missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DYNC1I2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | DYNC1I2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18182398
|
Novus Biologicals
NBP2-38469 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625225
|
Novus Biologicals
NBP2-38469-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DYNC1I2 Polyclonal specifically detects DYNC1I2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| DYNC1I2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q13409 | |
| 1781 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cytoplasmic dynein 1 intermediate chain 2, Cytoplasmic dynein intermediate chain 2, DH IC-2, DNCI2MGC104199, DNCIC2, Dynein intermediate chain 2, cytosolic, dynein, cytoplasmic 1, intermediate chain 2, dynein, cytoplasmic, intermediate polypeptide 2, FLJ21089, FLJ90842, IC2, MGC111094, MGC9324 | |
| DYNC1I2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title